OpenFold2 NIM
Predict a single protein-chain structure from an amino-acid sequence, with optional A3M multiple sequence alignments and mmCIF templates. Use this guide for basic hosted/local NIM use; load supplemental files only when the task needs deeper context:
references/api.md: exact endpoints, schemas, Docker flags, response fields.references/science.md: model scope, strengths, limitations, and handoffs.references/parameters.md: MSA, template, model-selection, and relax effects.references/validation.md: artifact and scientific sanity checks.references/examples.md: compact hosted/local payload patterns.
Choose Mode
Ask only when context is unclear:
Hosted NVIDIA API or local Docker NIM?
- Hosted URL:
https://health.api.nvidia.com/v1/biology/openfold/openfold2/predict-structure-from-msa-and-template - Local URL:
http://localhost:8000/biology/openfold/openfold2/predict-structure-from-msa-and-template - Local readiness:
http://localhost:8000/v1/health/ready
Mode difference: hosted and local use the same prediction path except local
does not include /v1/. Hosted requests use Authorization: Bearer $NGC_API_KEY; local inference requests use no auth header after readiness.
Auth And Environment
Do not print API keys. Confirm they exist with shell tests, not echoes.
Hosted needs NGC_API_KEY in the request header. Supported local Docker
startup uses NGC_API_KEY, or NVIDIA_API_KEY as a fallback, plus
LOCAL_NIM_CACHE. A repo-root .env file may be sourced as a local override.
Local Docker
Use the official OpenFold2 NIM image and mount LOCAL_NIM_CACHE at
/opt/nim/.cache. Current docs recommend at least 80 GB disk, 64 GB system
RAM, 8 CPU cores, and one supported GPU; the container is roughly 55 GB and
first startup downloads about 10 GB of model parameters.
For the exact startup preflight (.env sourcing, NGC_API_KEY/NVIDIA_API_KEY
handling, docker login, and the docker run for
nvcr.io/nim/openfold/openfold2:latest), copy the command block in
references/api.md under Local Docker verbatim — do
not drop .env, NGC_API_KEY, LOCAL_NIM_CACHE, or the no-auth local request.
Readiness check:
until curl -sf http://localhost:8000/v1/health/ready; do sleep 5; done
Request Pattern
Use Python requests; curl escaping is fragile for A3M/mmCIF text. The
sequence field is required. input_id, alignments, selected_models,
relax_prediction, use_templates, and explicit_templates are optional.
import os
import requests
hosted = True
url = (
"https://health.api.nvidia.com/v1/biology/openfold/openfold2/predict-structure-from-msa-and-template"
if hosted
else "http://localhost:8000/biology/openfold/openfold2/predict-structure-from-msa-and-template"
)
headers = {"Content-Type": "application/json"}
if hosted:
headers["Authorization"] = f"Bearer {os.getenv('NGC_API_KEY')}"
seq = "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPT"
payload = {
"sequence": seq,
"input_id": "kras_fragment",
"selected_models": [1],
"relax_prediction": False,
"alignments": {
"uniref90": {
"a3m": {
"alignment": f">query\n{seq}",
"format": "a3m",
}
}
},
}
response = requests.post(url, headers=headers, json=payload, timeout=300)
response.raise_for_status()
result = response.json()
Payload gotchas:
- OpenFold2 is monomer-only. For protein-ligand, protein-DNA/RNA, or multi-chain complexes, use OpenFold3 or Boltz2 instead.
sequencemust use valid amino-acid IUPAC symbols.- Hosted API docs list sequence length 1-1000; local docs say current NIM supports sequences up to 2048 residues on supported hardware.
- A3M alignments go under
alignmentsby database name, thena3mwithalignmentandformat. When the user needs to create or deepen an MSA, hand off tomsa-search-nim/ MSA Search and map its A3M output into thisalignmentsshape. - Starting with OpenFold2 2.0.0, use
explicit_templateswith mmCIF content; do not write new HHR-template examples. selected_modelschooses AlphaFold2/OpenFold parameter sets 1-5. Select one or two models for smoke tests; use all five for stronger production runs.
Save And Interpret Output
The response includes one prediction per selected model, ordered by confidence.
Save every returned structure-like text field and the full JSON response so
field-shape differences are auditable. Production answers should explicitly
write .pdb or .cif artifacts, preserve the response JSON, and print any
confidence/ranking fields the service returns.
from pathlib import Path
import json
Path("openfold2_response.json").write_text(json.dumps(result, indent=2))
def save_strings(obj, prefix="openfold2"):
i = 0
if isinstance(obj, dict):
for key, value in obj.items():
if isinstance(value, str) and ("ATOM" in value or value.lstrip().startswith("data_")):
i += 1
ext = "cif" if value.lstrip().startswith("data_") else "pdb"
Path(f"{prefix}_{key}_{i}.{ext}").write_text(value)
elif isinstance(value, (dict, list)):
i += save_strings(value, f"{prefix}_{key}")
elif isinstance(obj, list):
for idx, value in enumerate(obj, start=1):
if isinstance(value, (dict, list)):
i += save_strings(value, f"{prefix}_{idx}")
return i
saved = save_strings(result)
print(f"saved {saved} structure artifact(s)")
For production monomer runs:
- Use
selected_models: [1, 2, 3, 4, 5]unless the user requests a smoke test. - Use
relax_prediction: Truein Python payloads when relaxation is desired; JSON examples may showtrue. - State the sequence length caveat: hosted API docs list 1-1000 residues, while local support-matrix docs list up to 2048 residues on supported hardware.
- If the task is a complex rather than a monomer, redirect to OpenFold3 or Boltz2.
Treat tiny toy sequences and single-sequence MSAs as API smoke tests, not
quality evidence. For scientific interpretation and validation, read
references/science.md and references/validation.md.
Troubleshooting
401: missing, expired, or unauthorized NGC API key.422: invalid amino-acid characters, sequence too long, malformed A3M, badselected_models, or malformed mmCIF template object.- Local
404: remove/v1/from the prediction URL. - Weak structures: use MSA Search to generate deeper A3M alignments and add biologically relevant mmCIF templates when appropriate.
- Local startup stalls: first run downloads parameters into
LOCAL_NIM_CACHE.